Skip to main content

Table 2 Amino acid sequence of the VV protein E6R and identified peptides Peptides detected from the Method 1 (SDS-PAGE + LC-ESI-Q-TOF MS), Method 2 (SDS-PAGE + LC-ESI-QIT MS), Method 3 (HPLC + LC-ESI-QIT MS), Method 4 (LC-ESI-Q-TOF MS), and Method 5 (MALDI-TOF/TOF MS) are denoted with an asterisk (*). Peptides that are in bold print have been identified by at least one of the five methods.

From: Pox proteomics: mass spectrometry analysis and identification of Vaccinia virion proteins

Method MDFIRRKYLIYTVENNIDFLKDDTLSKVNNFTLNHVLALKYLVSNFPQHV
1                            ***********************
2        ********************             **********
3  
4  
5  
  ITK DVLANTNFFVFIHMVRCCKVYEAVLR HAFDAPTLYVK ALTKNYLSFS
1 ***                          ***********
2 ***                          ***********
3  
4  
5  
  NAIQSYKETVHKLTQDEK FLEVAEYMDELGELIGVNYDLVLNPLFHGGEP
1  
2  
3  
4                   ********************************
5  
  IK DMEIIFLKLFKKTDFKVVKKLSVIRLLIWAYLSKK DTGIEFADNDRQD
1                                      *************
2  
3  
4 **
5                                                 **
  IYTLFQQTGRIVHSNLTETFRDYIFPGDK TSYWVWLNESIANDADIVLNR
1 **********
2                      ********
3  
4  
5 *********************
  HAITMYDK ILSYIYSEIKQGRVNKNMLK LVYIFEPEKDIR ELLLEIIYDI
1                             ************
2 ********
3  
4  
5  
  PGDILSIIDAKNDDWKKYFISFYKANFINGNTFISDR TFNEDLFRVVVQI
1                                              *****
2                                      ********
3  
4                                      ********
5                                              *****
  DPEYFDNERIMSLFSTSAADIK RFDELDINNSYISNIIYEVNDITLDTMD
1 **********************
2  
3  
4  
5 *********
  DMKKCQIFNEDTSYYVKEYNTYLFLHESDPMVIENGILKKLSSIKSKSKR
1  
2  
3  
4  
5  
  LNLFSK NILKYYLDGQLAR LGLVLDDYKGDLLVKMINHLKSVEDVSAFVR
1                    ***************
2 ******             *******************************
3  
4  
5  
  FSTDKNPSILPSLIKTILASYNISIIVLFQRFLR DNLYHVEEFLDK SIHL
1                                   ************
2  
3  
4  
5  
  TKTDKK YILQLIR HGRS
1  
2  
3  
4  
5       *******