Skip to main content

Table 2 Alignment of preanchor domain sequences from representative flaviviruses.

From: Peptide inhibitors of dengue virus and West Nile virus infectivity

Virus a Pre-anchor sequence b Location c
   DENV-1 AILGDTAWDFGSIGGVFTSVGKLIHQIFGTA 693–723
   DENV-2 AILGDTAWDFGSLGGVFTSIGKALHQVFGAI 693–723
   DENV-3 AILGDTAWDFGSVGGVLNSLGKMVHQIFGSA 691–721
   DENV-4 AILGETAWDFGSVGGVLTSLGKAVHQVFGSV 692–722
   WNV AVLGDTAWDFGSVGGVFTSVGKAVHQVFGGA 709–739
   YFV AVMGDTAWDFSSAGGFFTSVGKGIHTVFGSA 695–725
   SLEV AVLGDTAWDFGSIGGVFTSIGKALHQVFGGA 707–737
   JEV AALGDTAWDFGSIGGVFNSIGKAVHQVFGGA 712–742
   TBEV TVIGEHAWDFGSAGGFLSSIGKAVHTVLGGA 694–724
   OHFV TVLGEHAWDFGSTGGFLSSIGKALHTVLGGA 694–724
   KFV TVVGEHAWDFGSVGGMLSSVGKALHTAFGAA 695–725
   POWV SVVGEHAWDFGSVGGVLSSVGKAIHTVLGGA 693–723
  1. aDENV: dengue virus; WNV: West Nile virus; YFV: yellow fever virus; SLEV: St. Louis encephalitis virus; JEV: Japanese encephalitis virus; TBEV: Tick-borne encephalitis virus; OHFV: Omsk hemorrhagic fever virus; KFV: Kyasanur Forest virus; POWV: Powassan virus
  2. b * = identical or chemically similar amino acids in every sequence
  3. cnumbering from the beginning of the E polyprotein.