Skip to main content

Table 1 Conserved HIV protein regions containing multiple epitopes

From: Synthetic immunotherapy induces HIV virus specific Th1 cytotoxic response and death of an HIV-1 infected human cell line through classic complement activation

Name Consensus sequence Locationa Length
VPR GDTWAGVEAIIRILQQLLFIHFRIGCQHSR 51 to 80 30
VIF KVGSLQYLALTALITPKKIKPPLPSVKKLTEDRWNKPQKT 142 to 181 40
REV EPVPLQLPPLERLTLDCSEDCGTSGTQ 69 to 95 27
NEF YKGALDLSHFLKEKGGLEGLIYSQKRQDILDLWVYHTQGYFPD 81 to 123 43
M1A* DLEALMEWLKTRPILSPLTKGILGFVFTLTVP 36 to 67 32
M1B* LLYCLMVMYLNPGNYSMQVKLGTLCALCEKQASHS 124 to 158 35
NPA* DLIFLARSALILRGSVAHKSC 255 to 275 21
NPB* PGIADIEDLTLLARSMVVVRP 306 to 326 21
PB1* LLIDGTASLSPGMMMGMFNMLSTVLGVSILNLGQ 395 to 428 34
M2* IIGILHLILWILDRLFFKCIYRLF 32 to 55 24
  1. aAmino acid location for each sequence is referenced to the consensus sequence defined for that protein. The length of the polypeptide is expressed as number of aminoacids. Marked with (*) are the aminoacid sequences component of NRP-v.