Skip to main content

Advertisement

Table 1 Characteristics of alfalfa-associated nucleorhabdovirus (AaNV) encoded proteins [sizes in amino acids (aa), molecular masses (MW) in kilo Dalton (kDa), the isoelectric points (IEP), predicted cell nuclear localisation signals (cNLS) and nuclear export signals (NES)]

From: Characterisation of a novel nucleorhabdovirus infecting alfalfa (Medicago sativa)

Putative gene function Gene Size (aa) MW (kDa) pairwise aa sequence identity (%) IEP Predicted NLS NES position
BCaRV-1 DYVV Position Partite aa sequence cNLS Mapper Score Predicted location
Nucleocapsid protein N 443 50.3 33.5 36.6 7.1 408 Bic RAGIKRQAGDHETQGTKRARTS 12.7 eN 351
Phosphoprotein P 363 41.1 11.5 14 6.4 146 Monod RGNKRRKRSD 10 eN ND
Putative cell-to-cell movement protein P3 322 37.2 14.6 22.4 8.6 17 Bi PTKKRTSQDKYNFRSTESLYAEPYNKIIRTK 7 pN ND
Matrix protein M 277 31.4 14.9 16.5 7.6 213 Bi RSSVKITGKQMRARSSSRSRSPYKVSLSSNKRTYLD 4.3 N/Cp 136
Unknown protein U 113 12.4 NAa NA 4.0 NDb ND ND ND NA 31
Glycoprotein G 629 71.6 26.4 24.6 7.3 443 Bi KSAYKKKLPYEVTAWNGDKIMSEYPYKNIVVE 6 pN ND
RNA-dependent RNA polymerase L 2038 234.8 35.8 36.7 7.8 780 Bi EKTAIKRRMRAFRDDLGQKMKKR 10 eN 88,90 and 149
  1. The amino acid sequence identities between the putative gene products of AaNV and those of black currant-associated rhabdovirus 1 (BCaRV-1; MF543022) and datura yellow vein virus (DYVV; NC_028231). The predicted protein cell nuclear localisation signal (cNLS; http://nls-mapper.iab.keio.ac.jp/cgi-bin/NLS_Mapper_form.cgi) Mapper score and Nuclear export signals (NES) are also mentioned. The cut-off values of the cNLS mapper scores: 8, 9, or 10 = the protein is predicted to be exclusively localised to the nucleus (eN), 6, 7 or 8 = partially localised to the nucleus (pN), 3, 4, or 5 = localised to both the nucleus and the cytoplasm (N/Cp), and 1 or 2 = localised to the cytoplasm (Cp). aNA: not applicable. bND: not detectable. cBi: Predicted bipartite NLSd Mono: Predicted monopartite NLS