Table 1 Characteristics of alfalfa-associated nucleorhabdovirus (AaNV) encoded proteins [sizes in amino acids (aa), molecular masses (MW) in kilo Dalton (kDa), the isoelectric points (IEP), predicted cell nuclear localisation signals (cNLS) and nuclear export signals (NES)]
From: Characterisation of a novel nucleorhabdovirus infecting alfalfa (Medicago sativa)
Putative gene function | Gene | Size (aa) | MW (kDa) | pairwise aa sequence identity (%) | IEP | Predicted NLS | NES position | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
BCaRV-1 | DYVV | Position | Partite | aa sequence | cNLS Mapper Score | Predicted location | ||||||
Nucleocapsid protein | N | 443 | 50.3 | 33.5 | 36.6 | 7.1 | 408 | Bic | RAGIKRQAGDHETQGTKRARTS | 12.7 | eN | 351 |
Phosphoprotein | P | 363 | 41.1 | 11.5 | 14 | 6.4 | 146 | Monod | RGNKRRKRSD | 10 | eN | ND |
Putative cell-to-cell movement protein | P3 | 322 | 37.2 | 14.6 | 22.4 | 8.6 | 17 | Bi | PTKKRTSQDKYNFRSTESLYAEPYNKIIRTK | 7 | pN | ND |
Matrix protein | M | 277 | 31.4 | 14.9 | 16.5 | 7.6 | 213 | Bi | RSSVKITGKQMRARSSSRSRSPYKVSLSSNKRTYLD | 4.3 | N/Cp | 136 |
Unknown protein | U | 113 | 12.4 | NAa | NA | 4.0 | NDb | ND | ND | ND | NA | 31 |
Glycoprotein | G | 629 | 71.6 | 26.4 | 24.6 | 7.3 | 443 | Bi | KSAYKKKLPYEVTAWNGDKIMSEYPYKNIVVE | 6 | pN | ND |
RNA-dependent RNA polymerase | L | 2038 | 234.8 | 35.8 | 36.7 | 7.8 | 780 | Bi | EKTAIKRRMRAFRDDLGQKMKKR | 10 | eN | 88,90 and 149 |