Skip to main content

Table 4 Epitope mapping of anti-V3 mAbs with consensus-C V3 overlapping peptides

From: Production and characterization of human anti-V3 monoclonal antibodies from the cells of HIV-1 infected Indian donors

  1Amino acid sequence of C2-V3-C3 overlapping peptides 2anti-V3 mAbs  
Peptide ID IIVHLNESVEIV CTRPNNNTRKSIRIGPGQTFYATGDIIGDIRQAHC NISEEKWNKTLQ 277 903 904 447-52D 1418
9256 IIVHLNESVEIVCTR >10 >10 >10 >10 >10
9257 LNESVEIVCTRPNNN >10 >10 >10 >10 >10
9258 VEIVCTRPNNNTRKS >10 >10 >10 >10 >10
9259 CTRPNNNTRKSIRIG >10 >10 >10 >10 >10
9260 NNNTRKSIRIGPGQT >10 >10 >10 0.049 >10
9261 RKSIRIGPGQTFYAT 4.04 1.37 0.327 0.149 >10
9262 RIGPGQTFYATGDII >10 >10 >10 >10 >10
9263 GQTFYATGDIIGDIR >10 >10 >10 >10 >10
9264 YATGDIIGDIRQAHC >10 >10 >10 >10 >10
9265 DIIGDIRQAHCNISE >10 >10 >10 >10 >10
9266 DIRQAHCNISEEKWN >10 >10 >10 >10 >10
9267 AHCNISEEKWNKTLQ >10 >10 >10 >10 >10
  1. 1Amino acid sequences of linear overlapping peptides encompassing the third variable region (V3: Underlined (middle)), flanked by second (C2: (left)) and third (C3: (right)) constant regions and are aligned with the corresponding consensus-C gp120 sequence.
  2. 2Four anti-V3 antibodies, three from IndianI (277, 903 and 904) and one from AmericanA (447-52D) HIV-1 infected donor were tested for their binding to overlapping peptides by ELISA using mAbs at a concentration ranging from 10 to 0.00003 μg/ml (12 dilutions).
  3. The 50% binding titers (Max50, conc. μg/ml) of each antibody against the corresponding peptides is depicted as numerical values in Bold (high affinity), Italic (low affinity) and >10, where Max50 value was not reached. Human anti-parvovirus B19 mAb 1418 was used as negative control. Each experiment was performed at least two independent times.