Skip to main content

Table 1 T-cell epitopes included in the synthesized T-cell immunogen

From: A pseudotype baculovirus expressing the capsid protein of foot-and-mouth disease virus and a T-Cell immunogen shows enhanced immunogenicity in mice

Epitopes Sequence Function
PADRE AKFVAAWTLKAAA TH
VP420-34 SIINNYYMQQYQNSM TH
VP4 62-81 TQNNDWFSKLASSAFSGLFG TH
VP1157-165 RTLPTSFNY Tc
VP126-34 RRQHTDVSF Tc
3A21-35 AAIEFFEGMVHDSIK TH
3D182-201 VDVLPVEHILYTRMMIGRFC TH
3D342-371 VVASDYDLDFEALKPHFKSLGQTITPADKS TH
Invasin TAKSKKFPSYTATYQF TH
  1. The T-cell epitopes were ligated sequentially via two glycines (Gs) as following: PADRE-GG-VP420-34-GG-VP4 62-81-GG-VP1157-165-GG-VP126-34-GG-3A21-35-GG-3D182-201-GG-3D342-371-GG- Invasin