Skip to main content

Advertisement

Table 1 Amino acid sequences of HCMV gB peptides

From: Peptide inhibition of human cytomegalovirus infection

Peptide Amino acid sequence Position
174-200 WEIHHINKFAQAYSSYSRVIGGTVFVA 174-200
233-263 WHSRGSTWLYRETANLNAMLTITTARSKYPY 233-263
264-291 HFFATSTGDVVYISPFYNGTNRNASYFG 264-291
297-315 FFIFPNYTIVSDFGRPNAA 297-315
  1. HCMV gB peptides were synthesized based on the amino acid sequence determined from GenBank accession no. DAA00160 (Human Herpesvirus 5 strain AD169).