Skip to main content

Table 2 Viable viruses.

From: Optimization of capsid-incorporated antigens for a novel adenovirus vaccine approach

A.   
Insert HVR2 HVR5
33RGD Motif + 12 aa Linker + +
43RGD Motif + 12 aa Linker - +
53RGD Motif + 12 aa Linker - +
63RGD Motif + 12 aa Linker - -
73RGD Motif + 12 aa Linker - -
83RGD Motif + 12 aa Linker - -
(+) = viable viruses (-) = not viable viruses.
B.   
33RGD motif- AAAMQPVEDMNDHAI RGD TFATRAEEKRAEAEA
43RGD motif- NSNAAAAAMQPVEDMNDHAI RGD TFATRAEEKRAEAEAAAEAA
53RGD motif- SGAEENSNAAAAAMQPVEDMNDHAI RGD TFATRAEEKRAEAEAAAEAAAPAAQ
63RGD motif- SNSSGSGAEENSNAAAAAMQPVEDMNDHAI RGD TFATRAEEKRAEAEAAAEAAAPAAQPEVEK
73RGD motif- GGAGGSNSSGSGAEENSNAAAAAMQPVEDMNDHAI RGD TFATRAEEKRAEAEAAAEAAAPAAQPEVEKPQKKP
83RGD motif- TEQGGGGAGGSNSSGSGAEENSNAAAAAMQPVEDMNDHAI RGD TFATRAEEKRAEAEAAAEAAAPAAQPEVEKPQKKPVIKPL
  1. Core Arg-Gly-Asp (RGD) motif italicized and underlined