Skip to main content

Table 3 Amino acid sequence of the VV protein L3L and identified peptides Peptides detected from the Method 1 (SDS-PAGE + LC-ESI-Q-TOF MS), Method 2 (SDS-PAGE + LC-ESI-QIT MS), Method 3 (HPLC + LC-ESI-QIT MS), Method 4 (LC-ESI-Q-TOF MS), and Method 5 (MALDI-TOF/TOF MS) are denoted with an asterisk (*). Peptides that are in bold print have been identified by at least one of the five methods.

From: Pox proteomics: mass spectrometry analysis and identification of Vaccinia virion proteins

Method MNTRTDVTNDNIDKNPTKRGDRNIPGRNERFNDQNRFNNDRPRPKPRLQP
1     **************
2     **************
3  
4     **************
5  
  NQPPKQDNKCREENGDFINIRLCAYEKEYCNDGYLSPAYYMLKQVDDEEM
1  
2  
3  
4  
5  
  SCWSELSSLVRSRK AVGFPLLK AAKRISHGSMLYFEQLKNSKVVKLTPQV
1  
2  
3  
4               ********
5  
  KCLNDTVIFQTVVILYSMYKRGIYSNEFCFDLVSIPRTNIVFSVNQLMFN
1  
2  
3  
4  
5  
  ICTDILVVLSICGNRLYRTNLPQSCYLNFIHGHETIARR GYEHSNYFFEW
1  
2  
3  
4  
5                                        ***********
  LIKNHISLLTKQTMDILK VKKKYATGAPVNRLLEPGTLVYVPKEDYYFIG
1  
2    ***************
3  
4            *******
5 ***
  ISLTDVSISDNVR VLFSTDGIVLEIEDFNIKHLFMAGEMFVR SQSSTIIV
1  
2  
3  
4              ******************
5              *****************************