Skip to main content

Advertisement

Table 4 Major sequence polymorphisms found in the groups studied.

From: HBx M130K and V131I (T-A) mutations in HBV genotype F during a follow-up study in chronic carriers

Amino acid-Position-mutation Frequency (%) Consensus sequences
L5M 28 Group A: 17 recovered patients
Q8K 22  
T12A 36  
S29P 38  
S31P 30  
S33P 30  
V37I 33  
P40S 30 Group B: 7 acute-chronic patients
MAARLCCQLDP-RDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDGSHLSLRGLPV CSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDW EELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA*
D48N 25  
R87W 30  
R103W 33  
T106P 25 Group B: 32 chronic patients
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDGSHLSLRGLPV CSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDW EELGEEIRL- - FVLGGCRHKLVCSPAPCNFFTSA*
D110E 33  
K130M 24  
V131I 27  
Deleted nt 8 Consensus Deletion group 8 bp
MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDGSHLSLRGLPV CSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGLSGRSMTWIEDYIKDCVFKDW EELGEEIRLNIRRL*
390-397   
end codon   
135 aa   
  1. Hyphens in the consensus sequence represent the amino acid polymorphism associated with the left column. The predicted consensus amino acid sequence was obtained with Bioedit Software from the nucleotide sequence of the sample study.