Skip to main content

Advertisement

Table 1 Initial peptides synthesized and tested for inhibitory activity.

From: Peptide inhibitors of dengue virus and West Nile virus infectivity

Peptide Sequence Locationa Concentration (μM) % Inhibition +/- SD
DN80 MVDRGWGNHAGLFGKGSIV 386–400 49.9 17 +/- 10
DN57 AWLVHTQWFLDLPLPWLPGADTQGSNWI 485–503 30.6 7 +/- 4
DN81 AWLVHRQWFLDLPLPWLPG 485–512 42.6 25 +/- 8
DN59 MAILGDTAWDFGSLGGVFTSIGKALHQVFGAIY 692–724 29.0 93 +/- 2
WN82 VVDRGWGNGAGLFGKGSID 396–410 52.5 4 +/- 13
WN53 TFLVHREWFMDLNLPWSSAGSTVWR 500–518 98.7 56 +/- 5
WN83 TFLVHREWFMDLNLPWSSA 500–524 128.0 70 +/- 2
  1. a numbering from the beginning of the E polyprotein in either DENV or WNV.