Skip to main content

Advertisement

Table 2 Alignment of amino acid sequences in the highly polymorphic region (HPR) of the HE gene from selected low pathogenic infectious salmon anaemia virus (ISAV-HPR0) isolates worldwide

From: Infectious salmon anaemia virus (ISAV) in Chilean Atlantic salmon (Salmo salar) aquaculture: emergence of low pathogenic ISAV-HPR0 and re-emergence of virulent ISAV-HPR∆: HPR3 and HPR14

Group ISAV (GenBank Acc. No) Predicted amino acid sequence1 aa deleted
HPRO Canada 980712 (AY46060) TDV-JIRDAIPPQTFNTFNQPSTSVLSNIFISM-GVA 0
HPRO U. K. NWM10 (FJ178189) TDV-KIRDAIPPQLNQTFNTNQPSTSVLSNIFISM-GVA 0
HPRO USA USA2004 (AY973194) TDV-KIRVDAIPPQLNQTFNTNQVEQPSTSVLSNIFISM-GVA 0
HPRO Faroe Island FO/03/06 (HQ664993) TDV-KIRVDAIPPQLNQTFNTNQVEQPSTSVLSNIFISM-GVA 0
HPRO Faroe Island FO/03b/07 (HQ664997) TDV-KIRVDAIPPQLNQTFNTNQVEQPSTSVLSNIFISM-GVA 0
HPRO Faroe Island FO/08/07 (HQ664998) TDV-KIRVDAIPPQLNQTFNTNQVEQPSTSVLSNIFISM-GVA 0
HPRO Faroe Island FO/01/06 (HQ664992) TDV-KIRVDAIPPQLNQTFNTNQVEQPANSVLSNIFISM-GVA 0
HPRO Faroe Island FO/01/08 (HQ664999) TDV-KIRVDAIPPQLNQTFNTNQVEQPANSVLSNIFISM-GVA 0
HPRO Faroe Island FO/01a/08 (HQ664994) TDV-KIRVDAIPPQLNQTFNTNQVEQPANSVLSNIFISM-GVA 0
HPRO Faroe Island FO/01b/07 (HQ664995) TDV-KIRVDAIPPQLNQTFNTNQVEQPANSVLSNIFISM-GVA 0
HPRO Scotland 1703/01/86 (AJ440971) TDV-KIRVDAIPPQLNQTFNTNQVEQPANSVLSNIFISM-GVA 0
HPRO Norway FM173/11 (JN711060) TDV-KIRVDAIPPQLNQTFNTNQVEQPANSVLSNIFISM-GVA 0
HPRO Norway H97/04 (DQ108604) TDV-KIRVDAIPPQLNQTFNTNQVEQPATSVLSNIFISM-GVA 0
HPRO Norway H138/08 (JN711063) TDV-KIRVDAIPPQLNQTFNTNQVEQPATSVLSNIFISM-GVA 0
HPRO Chile CGA/1059 (KC414113) TDV-KIRVDAIPPQLNQTFNTNQVEQPATSVLSNIFISM-GVA 0
HPRO Chile CGA/ID758 (KF019742) TDV-KIRVDAIPPQLNQTFNTNQVEQPATSVLSNIFISM-GVA 0
HPRO Scotland Scot157/08 (JN711096) TDV-KIRVDAIPPQLNQTFNTNQVEQPATSVLSNIFISM-GVA 0
HPRO Canada EF6-6 (AY646058) TDV-KIRVDAIPPQLNQTFNTNQVEQPATSVLSNIFISM-GVA 0
  1. 1The characteristic residue patterns representing the three different ISAV-HPR0 subgroups are in bold.